PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11884_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 173aa    MW: 19796.1 Da    PI: 5.8822
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11884_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.72e-081221552154
                                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           k +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_11884_iso_6_len_2780_ver_3 122 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 155
                                           469*****************************87 PP

2ELK28.43.7e-107697122
                                   ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                                          ELK++L+++Y+++++++++E++
  cra_locus_11884_iso_6_len_2780_ver_3 76 ELKRELKQGYKEKIVDIREEIL 97
                                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.9177696IPR005539ELK domain
PfamPF037891.3E-67697IPR005539ELK domain
SMARTSM011880.00177697IPR005539ELK domain
PROSITE profilePS5007111.72696159IPR001356Homeobox domain
SMARTSM003892.4E-1198163IPR001356Homeobox domain
SuperFamilySSF466896.84E-1798162IPR009057Homeodomain-like
CDDcd000863.97E-1199160No hitNo description
Gene3DG3DSA:1.10.10.606.0E-26103160IPR009057Homeodomain-like
PfamPF059203.1E-18116155IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MEAVMACWEI EQSLQSLTGV SPGEGTGATM SDDDDDQVDS DANLFDGSLD DPDSMGFGPL  60
IPTESERSLM ERVRQELKRE LKQGYKEKIV DIREEILRKR RAGKLPGDTT SVLKAWWQSH  120
SKWPYPTEED KARLVQETGL QLKQINNWFI NQRKRNWHSN PSSSTASKSK RKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-1499163872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152172RKRNWHSNPSSSTASKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578127.11e-117PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_007136985.11e-117hypothetical protein PHAVU_009G090500g
SwissprotP480001e-112KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2R7P71e-119A0A0B2R7P7_GLYSO; Homeobox protein knotted-1-like 3
TrEMBLA0A0V0ID041e-118A0A0V0ID04_SOLCH; Putative homeobox protein knotted-1-like 3-like
STRINGPOPTR_0006s27560.11e-117(Populus trichocarpa)
STRINGGLYMA04G06810.11e-117(Glycine max)